| Product Number |
ARP40156_P050 |
| Product Page |
www.avivasysbio.com/elf3-antibody-middle-region-arp40156-p050.html |
| Name |
Elf3 Antibody - middle region (ARP40156_P050) |
| Protein Size (# AA) |
371 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
13710 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
E74-like factor 3 |
| Alias Symbols |
ES, je, ESX, jen, ESE-, ESE-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Elf3 is a transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. It acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter (By similarity). It also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. IT represses KRT4 promoter activity (By similarity). It may play an important role in epithelial cell differentiation and tumorigenesis and may be a critical downstream effector of the ERBB2 signaling pathway (By similarity). It may be associated with mammary gland development and involution. It plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Elf3 (ARP40156_P050) antibody |
| Blocking Peptide |
For anti-Elf3 (ARP40156_P050) antibody is Catalog # AAP40156 (Previous Catalog # AAPP23358) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse Elf3 |
| Uniprot ID |
Q3UPW2-2 |
| Protein Name |
ETS-related transcription factor Elf-3 |
| Protein Accession # |
NP_031947 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007921 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Elf3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Horse: 86%; Human: 79%; Mouse: 100%; Pig: 79%; Rabbit: 79%; Rat: 93% |
| Image 1 | Mouse Trachea
 | WB Suggested Anti-Elf3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Trachea |
|
|
