SIRT5 Antibody - C-terminal region (ARP40125_T100)

• Product Number: ARP40125_T100
• Name: SIRT5 Antibody - C-terminal region (ARP40125_T100)
• Protein Size (# AA): 299 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 23408
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Sirtuin 5
• Description:
  View product citations for SIRT5 Antibody - C-terminal region (ARP40125_T100) on CiteAb
• Alias Symbols: SIR2L5
• Peptide Sequence: Synthetic peptide located within the following region: HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFSHLIS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mahlknecht,U., et al., (2006) Cytogenet. Genome Res. 112 (3-4), 208-212
• Description of Target: SIRT5 is included in class III of the sirtuin family which ischaracterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity.
• Protein Interactions: SIRT3; UBC; HECW2; APP; RELA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SIRT5 (ARP40125_T100) antibody is Catalog # AAP40125 (Previous Catalog # AAPP10095)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SIRT5
• Uniprot ID: Q5T295
• Protein Name: NAD-dependent protein deacylase sirtuin-5, mitochondrial
• Publications:

  Impact of acute kidney injury on renal allograft survival. Ren Fail. 39, 40-44 (2017). 27776444

  Intracellular nicotinamide adenine dinucleotide promotes TNF-induced necroptosis in a sirtuin-dependent manner. Cell Death Differ. 23, 29-40 (2016). 26001219

• Sample Type Confirmation:

  There is BioGPS gene expression data showing that SIRT5 is expressed in HEK293T

• Protein Accession #: NP_112534
• Purification: Protein A purified
• Nucleotide Accession #: NM_006800
• Tested Species Reactivity: Human
• Gene Symbol: SIRT5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Goat: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
• Image 1: Human HEK293T
  
  Lanes:
  Lane1: Untransfected HEK293T lysate
  Lane2: mSIRT5-FLAG transfected HEK293T lysate
  Primary Antibody Dilution:
  1:200
  Secondary Antibody:
  ProteinA-HRP
  Secondary Antibody Dilution:
  1:5000
  Gene Name:
  SIRT5
  Submitted by:
  Anonymous
  There is BioGPS gene expression data showing that SIRT5 is expressed in HEK293T
• Image 2: Human Heart
  
  WB Suggested Anti-SIRT5 Antibody Titration: 5.0ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human heart