| Product Number |
ARP40119_T100 |
| Product Page |
www.avivasysbio.com/evx2-antibody-n-terminal-region-arp40119-t100.html |
| Name |
EVX2 Antibody - N-terminal region (ARP40119_T100) |
| Protein Size (# AA) |
476 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
344191 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Even-skipped homeobox 2 |
| Alias Symbols |
EVX-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MMERIRKEMILMERGLHSPTAGKRFSNLSNSAGNAVLEALENSQHPARLS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
LOC344191 is a new candidate transcription factor. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EVX2 (ARP40119_T100) antibody |
| Blocking Peptide |
For anti-EVX2 (ARP40119_T100) antibody is Catalog # AAP40119 (Previous Catalog # AAPP23463) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LOC344191 |
| Uniprot ID |
Q03828 |
| Protein Name |
Homeobox even-skipped homolog protein 2 |
| Protein Accession # |
NP_001073927 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001080458 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EVX2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-EVX2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
|
|
