| Product Number |
ARP40116_P050 |
| Product Page |
www.avivasysbio.com/mgc46336-antibody-n-terminal-region-arp40116-p050.html |
| Name |
MGC46336 Antibody - N-terminal region (ARP40116_P050) |
| Protein Size (# AA) |
348 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
283933 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 843 |
| Peptide Sequence |
Synthetic peptide located within the following region: GFTQSASLLQHWRVHSDWRETLSLSPVRQDLLWPLQPHQAPASPLGRSHS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg RL, Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11. |
| Description of Target |
The function remains unknows. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF843 (ARP40116_P050) antibody |
| Blocking Peptide |
For anti-ZNF843 (ARP40116_P050) antibody is Catalog # AAP40116 (Previous Catalog # AAPP22011) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MGC46336 |
| Uniprot ID |
Q8N446 |
| Protein Name |
Zinc finger protein 843 |
| Protein Accession # |
XP_290712 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_290712 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF843 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-MGC46336 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
|
