ZBTB38 Antibody - N-terminal region (ARP40114_T100)

Data Sheet
 
Product Number ARP40114_T100
Product Page www.avivasysbio.com/zbtb38-antibody-n-terminal-region-arp40114-t100.html
Name ZBTB38 Antibody - N-terminal region (ARP40114_T100)
Protein Size (# AA) 1192 amino acids
Molecular Weight 131kDa
NCBI Gene Id 253461
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger and BTB domain containing 38
Alias Symbols CIBZ, ZNF921, PPP1R171
Peptide Sequence Synthetic peptide located within the following region: MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Filion GJ,.(2006) Mol Cell Biol. Jan;26(1):169-81.
Description of Target ZBTB38 contains 10 C2H2-type zinc fingers and 1 BTB (POZ) domain. ZBTB38 acts as a transcriptional activator and may be involved in the differentiation and/or survival of late postmitotic neurons.
Protein Interactions KRTAP10-9; KRTAP10-7; KRT40; FSD2; TRIM41; LZTS2; TSGA10; CCDC136; MTUS2; RALBP1; EHMT2; PDE4DIP; CBFA2T3; PPP1CA; HHV8GK18_gp81; UBC; RBBP6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZBTB38 (ARP40114_T100) antibody
Blocking Peptide For anti-ZBTB38 (ARP40114_T100) antibody is Catalog # AAP40114 (Previous Catalog # AAPP22009)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB38
Uniprot ID Q8NAP3
Protein Name Zinc finger and BTB domain-containing protein 38
Protein Accession # XP_001133510
Purification Protein A purified
Nucleotide Accession # XM_001133510
Tested Species Reactivity Human
Gene Symbol ZBTB38
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 91%; Rat: 100%
Image 1
Human Hela
Host: Rabbit
Target Name: ZBTB38
Sample Tissue: Human Hela
Antibody Dilution: 1.0ug/ml
Image 2
HeLa Cell Lysate, 293T Cell Lysate
Host: Rabbit
Target: ZBTB38
Positive control (+): HeLa Cell Lysate (HL)
Negative control (-): 293T Cell Lysate (2T)
Antibody concentration: 3ug/ml
Image 3
Human kidney
Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com