| Product Number |
ARP40110_P050 |
| Product Page |
www.avivasysbio.com/nobox-antibody-n-terminal-region-arp40110-p050.html |
| Name |
NOBOX Antibody - N-terminal region (ARP40110_P050) |
| Protein Size (# AA) |
490 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
135935 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
NOBOX oogenesis homeobox |
| Alias Symbols |
OG2, OG-2, OG2X, POF5, TCAG_12042 |
| Peptide Sequence |
Synthetic peptide located within the following region: FPVCGLYRIYGVCGSFSSFFIIRCSLCALETLKSPQHDPLEIPEQSLKLI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Huntriss J, (2006) Mol Hum Reprod. 2006 May;12(5):283-9. |
| Description of Target |
NOBOX is a transcription factor which may play a role in oogenesis. It binds preferentially to the DNA sequences 5'-TAATTG-3', 5'-TAGTTG-3' and 5'-TAATTA-3'. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NOBOX (ARP40110_P050) antibody |
| Blocking Peptide |
For anti-NOBOX (ARP40110_P050) antibody is Catalog # AAP40110 (Previous Catalog # AAPP22944) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NOBOX |
| Uniprot ID |
O60393 |
| Protein Accession # |
XP_001134424 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_001134424 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NOBOX |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Heart
 | Human Heart |
| | Image 2 | Human Liver
 | Human Liver |
| | Image 3 | Human HepG2
 | WB Suggested Anti-NOBOX Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
|
