RFX4 Antibody - N-terminal region (ARP40086_P050)

• Product Number: ARP40086_P050
• Name: RFX4 Antibody - N-terminal region (ARP40086_P050)
• Protein Size (# AA): 563 amino acids
• Molecular Weight: 64kDa
• NCBI Gene Id: 5992
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Regulatory factor X, 4 (influences HLA class II expression)
• Alias Symbols: NYD-SP10
• Peptide Sequence: Synthetic peptide located within the following region: STESWIERCLNESENKRYSSHTSLGNVSNDENEEKENNRASKPHSTPATL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Glaser,B., (2005) Mol. Psychiatry 10 (10), 920-927
• Description of Target: RFX4 is a transcription factors that contain a highly-conserved winged helix DNA binding domain. RFX4 is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1. RFX4 may be a transcriptional repressor rather than a transcriptional activator.This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1. This protein may be a transcriptional repressor rather than a transcriptional activator. Three transcript variants encoding different isoforms have been described for this gene.This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1. This protein may be a transcriptional repressor rather than a transcriptional activator. Three transcript variants encoding different isoforms have been described for this gene.
• Protein Interactions: RFX3; RFX2; ESR1; RFX4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RFX4 (ARP40086_P050) antibody is Catalog # AAP40086 (Previous Catalog # AAPP21982)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RFX4
• Uniprot ID: Q33E94-4
• Protein Name: Transcription factor RFX4
• Protein Accession #: NP_002911
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002920
• Tested Species Reactivity: Human
• Gene Symbol: RFX4
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100%
• Image 1: Human Brain
  
  WB Suggested Anti-RFX4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human brain
• Image 2: Human Ovary Tumor
  
  Host: Rabbit
  Target Name: RFX4
  Sample Tissue: Human Ovary Tumor
  Antibody Dilution: 1ug/ml