ZNF326 Antibody - C-terminal region (ARP40068_T100)

Data Sheet
 
Product Number ARP40068_T100
Product Page www.avivasysbio.com/znf326-antibody-c-terminal-region-arp40068-t100.html
Name ZNF326 Antibody - C-terminal region (ARP40068_T100)
Protein Size (# AA) 582 amino acids
Molecular Weight 66kDa
NCBI Gene Id 284695
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 326
Alias Symbols ZIRD, ZAN75, Zfp326, dJ871E2.1
Peptide Sequence Synthetic peptide located within the following region: GNIQGVGEGGEVGVVGEVEGVGEVEEVEELEEETAKEEPADFPVEQPEEN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target ZNF326 is a candidate transcription factor
Protein Interactions FBXW11; SUMO2; SUMO3; RNF2; BMI1; SUZ12; EED; HDAC11; UBC; VCP; LOC255308; THOC6; SF3B6; HP1BP3; PRPF6; SF3B1; SF3A1; BUD31; UQCRC2; SRSF1; IK; SLC25A10; SEPT7; S100A9; PPP1CA; MED1; NHP2L1; NFIA; SEPT2; HNRNPM; ILF3; UBD; CAND1; DCUN1D1; CUL3; POLR2C; PO
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF326 (ARP40068_T100) antibody
Blocking Peptide For anti-ZNF326 (ARP40068_T100) antibody is Catalog # AAP40068 (Previous Catalog # AAPP23459)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF326
Uniprot ID Q5BKZ1
Protein Name DBIRD complex subunit ZNF326
Protein Accession # NP_892021
Purification Protein A purified
Nucleotide Accession # NM_182976
Tested Species Reactivity Human
Gene Symbol ZNF326
Predicted Species Reactivity Human, Rat, Dog
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 79%; Human: 100%; Rat: 93%
Image 1
Human kidney
Human kidney
Image 2
Human Liver
Human Liver
Image 3
Human Jurkat
WB Suggested Anti-ZNF326 Antibody Titration: 0.625ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com