ZSCAN2 Antibody - N-terminal region (ARP40048_P050)

Data Sheet
 
Product Number ARP40048_P050
Product Page www.avivasysbio.com/zscan2-antibody-n-terminal-region-arp40048-p050.html
Name ZSCAN2 Antibody - N-terminal region (ARP40048_P050)
Protein Size (# AA) 613 amino acids
Molecular Weight 67kDa
NCBI Gene Id 54993
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger and SCAN domain containing 2
Alias Symbols ZFP29, ZNF854
Peptide Sequence Synthetic peptide located within the following region: TTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Denny,P. (1991) Gene 106 (2), 221-227
Description of Target ZSCAN2 contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that ZSCAN2 is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells.The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms.The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms.
Protein Interactions HDAC8; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZSCAN2 (ARP40048_P050) antibody
Blocking Peptide For anti-ZSCAN2 (ARP40048_P050) antibody is Catalog # AAP40048 (Previous Catalog # AAPP22920)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZSCAN2
Uniprot ID Q7Z7L9
Protein Name Zinc finger and SCAN domain-containing protein 2
Protein Accession # NP_870992
Purification Affinity Purified
Nucleotide Accession # NM_181877
Tested Species Reactivity Human
Gene Symbol ZSCAN2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 86%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-ZSCAN2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com