Product Number |
ARP40048_P050 |
Product Page |
www.avivasysbio.com/zscan2-antibody-n-terminal-region-arp40048-p050.html |
Name |
ZSCAN2 Antibody - N-terminal region (ARP40048_P050) |
Protein Size (# AA) |
613 amino acids |
Molecular Weight |
67kDa |
NCBI Gene Id |
54993 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger and SCAN domain containing 2 |
Alias Symbols |
ZFP29, ZNF854 |
Peptide Sequence |
Synthetic peptide located within the following region: TTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Denny,P. (1991) Gene 106 (2), 221-227 |
Description of Target |
ZSCAN2 contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that ZSCAN2 is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells.The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms.The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms. |
Protein Interactions |
HDAC8; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZSCAN2 (ARP40048_P050) antibody |
Blocking Peptide |
For anti-ZSCAN2 (ARP40048_P050) antibody is Catalog # AAP40048 (Previous Catalog # AAPP22920) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZSCAN2 |
Uniprot ID |
Q7Z7L9 |
Protein Name |
Zinc finger and SCAN domain-containing protein 2 |
Protein Accession # |
NP_870992 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_181877 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZSCAN2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 86%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZSCAN2 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
|