| Product Number |
ARP40040_P050 |
| Product Page |
www.avivasysbio.com/hkr1-antibody-n-terminal-region-arp40040-p050.html |
| Name |
HKR1 Antibody - N-terminal region (ARP40040_P050) |
| Protein Size (# AA) |
659 amino acids |
| Molecular Weight |
75kDa |
| NCBI Gene Id |
284459 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
HKR1, GLI-Kruppel zinc finger family member |
| Alias Symbols |
HKR1 |
| Peptide Sequence |
Synthetic peptide located within the following region: RDVAVYFTQEEWRLLSPAQRTLHREVMLETYNHLVSLEIPSSKPKLIAQL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Oguri,T., (1998) Gene 222 (1), 61-67 |
| Description of Target |
HKR1 belongs to the krueppel C2H2-type zinc-finger protein family.It may be involved in transcriptional regulation. |
| Protein Interactions |
CDK11A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HKR1 (ARP40040_P050) antibody |
| Blocking Peptide |
For anti-HKR1 (ARP40040_P050) antibody is Catalog # AAP40040 (Previous Catalog # AAPP22919) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HKR1 |
| Uniprot ID |
P10072 |
| Protein Name |
Krueppel-related zinc finger protein 1 |
| Protein Accession # |
NP_861451 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_181786 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HKR1 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 92%; Rabbit: 93%; Rat: 92% |
| Image 1 | Human Placenta
 | WB Suggested Anti-HKR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Placenta |
|
|
