| Product Number |
ARP40028_T100 |
| Product Page |
www.avivasysbio.com/rnf113b-antibody-c-terminal-region-arp40028-t100.html |
| Name |
RNF113B Antibody - C-terminal region (ARP40028_T100) |
| Protein Size (# AA) |
322 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
140432 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Ring finger protein 113B |
| Alias Symbols |
RNF161, ZNF183L1, bA10G5.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: HYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQKLQAAEGKKR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
RNF113B contains 1 RING-type zinc finger and 1 C3H1-type zinc finger and the function remains unknown. |
| Protein Interactions |
UBE2R2; UBE2L3; UBE2H; UBE2U; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RNF113B (ARP40028_T100) antibody |
| Blocking Peptide |
For anti-RNF113B (ARP40028_T100) antibody is Catalog # AAP40028 (Previous Catalog # AAPP21934) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RNF113B |
| Uniprot ID |
Q8IZP6 |
| Protein Name |
RING finger protein 113B |
| Protein Accession # |
NP_849192 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_178861 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RNF113B |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-RNF113B Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
