TFAP2E Antibody - C-terminal region (ARP40023_T100)

• Product Number: ARP40023_T100
• Name: TFAP2E Antibody - C-terminal region (ARP40023_T100)
• Protein Size (# AA): 434 amino acids
• Molecular Weight: 45kDa
• NCBI Gene Id: 339488
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Transcription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon)
• Alias Symbols: AP2E, AP-2epsilon
• Peptide Sequence: Synthetic peptide located within the following region: FGGPAICAALTAFQNYLLESLKGLDKMFLSSVGSGHGETKASEKDAKHRK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Tummala,R., Gene 321, 93-102 (2003)
• Description of Target: TFAP2E belongs to AP-2 family of transcription factors which play an important role in regulating gene expression during development and differentiation of multiple organs and tissues. It may play an important role in skin biology.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TFAP2E (ARP40023_T100) antibody is Catalog # AAP40023 (Previous Catalog # AAPP21929)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2E
• Uniprot ID: Q8IW12
• Protein Name: Transcription factor AP-2-epsilon
• Protein Accession #: NP_848643
• Purification: Protein A purified
• Nucleotide Accession #: NM_178548
• Tested Species Reactivity: Human
• Gene Symbol: TFAP2E
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%
• Image 1: Transfected 293T
  
  WB Suggested Anti-TFAP2E Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:312500
  Positive Control: Transfected 293T