DLX1 Antibody - N-terminal region (ARP40020_P050)

Data Sheet
 
Product Number ARP40020_P050
Product Page www.avivasysbio.com/dlx1-antibody-n-terminal-region-arp40020-p050.html
Name DLX1 Antibody - N-terminal region (ARP40020_P050)
Protein Size (# AA) 255 amino acids
Molecular Weight 27kDa
NCBI Gene Id 1745
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Distal-less homeobox 1
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kahler,A.K., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press
Description of Target DLX1 is a member of a homeobox transcription factor family. It is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. DLX1 may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Interactions SMAD4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DLX1 (ARP40020_P050) antibody
Blocking Peptide For anti-DLX1 (ARP40020_P050) antibody is Catalog # AAP40020 (Previous Catalog # AAPP21926)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DLX1
Uniprot ID P56177
Protein Name Homeobox protein DLX-1
Protein Accession # NP_835221
Purification Affinity Purified
Nucleotide Accession # NM_178120
Tested Species Reactivity Human
Gene Symbol DLX1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human THP-1
WB Suggested Anti-DLX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com