Product Number |
ARP40020_P050 |
Product Page |
www.avivasysbio.com/dlx1-antibody-n-terminal-region-arp40020-p050.html |
Name |
DLX1 Antibody - N-terminal region (ARP40020_P050) |
Protein Size (# AA) |
255 amino acids |
Molecular Weight |
27kDa |
NCBI Gene Id |
1745 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Distal-less homeobox 1 |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kahler,A.K., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press |
Description of Target |
DLX1 is a member of a homeobox transcription factor family. It is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. DLX1 may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described. |
Protein Interactions |
SMAD4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DLX1 (ARP40020_P050) antibody |
Blocking Peptide |
For anti-DLX1 (ARP40020_P050) antibody is Catalog # AAP40020 (Previous Catalog # AAPP21926) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DLX1 |
Uniprot ID |
P56177 |
Protein Name |
Homeobox protein DLX-1 |
Protein Accession # |
NP_835221 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_178120 |
Tested Species Reactivity |
Human |
Gene Symbol |
DLX1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human THP-1
| WB Suggested Anti-DLX1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: THP-1 cell lysate |
|
|