ZNF575 Antibody - C-terminal region (ARP40010_T100)

Data Sheet
 
Product Number ARP40010_T100
Product Page www.avivasysbio.com/znf575-antibody-c-terminal-region-arp40010-t100.html
Name ZNF575 Antibody - C-terminal region (ARP40010_T100)
Protein Size (# AA) 245 amino acids
Molecular Weight 27kDa
NCBI Gene Id 284346
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 575
Peptide Sequence Synthetic peptide located within the following region: RLCHDPPTAPGSQATAWHRCSSCGQAFGQRRLLLLHQRSHHQVEHKGERD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hara,S., Unpublished (2003)
Description of Target ZNF575 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF575 (ARP40010_T100) antibody
Blocking Peptide For anti-ZNF575 (ARP40010_T100) antibody is Catalog # AAP40010 (Previous Catalog # AAPP22206)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF575
Uniprot ID Q86XF7
Protein Name Zinc finger protein 575
Protein Accession # NP_777605
Purification Protein A purified
Nucleotide Accession # NM_174945
Tested Species Reactivity Human
Gene Symbol ZNF575
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-ZNF575 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com