| Product Number |
ARP40004_P050 |
| Product Page |
www.avivasysbio.com/znf707-antibody-n-terminal-region-arp40004-p050.html |
| Name |
ZNF707 Antibody - N-terminal region (ARP40004_P050) |
| Protein Size (# AA) |
369 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
286075 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 707 |
| Peptide Sequence |
Synthetic peptide located within the following region: EPSQRALYRDVMLDNFSSVAALGFCSPRPDLVSRLEQWEEPWVEDRERPE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
ZNF707 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
| Protein Interactions |
KRTAP10-5; KRTAP10-7; CCNDBP1; RALBP1; MDFI; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF707 (ARP40004_P050) antibody |
| Blocking Peptide |
For anti-ZNF707 (ARP40004_P050) antibody is Catalog # AAP40004 (Previous Catalog # AAPP22204) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF707 |
| Uniprot ID |
Q96C28 |
| Protein Name |
Zinc finger protein 707 |
| Protein Accession # |
NP_776192 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_173831 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF707 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 85%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 85%; Rat: 85% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF707 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
|
