Product Number |
ARP39996_P050 |
Product Page |
www.avivasysbio.com/mkx-antibody-c-terminal-region-arp39996-p050.html |
Name |
Mkx Antibody - C-terminal region (ARP39996_P050) |
Protein Size (# AA) |
354 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
210719 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Mohawk homeobox |
Alias Symbols |
Ir, Irxl1, 9430023B20Rik |
Peptide Sequence |
Synthetic peptide located within the following region: GDSAANRRGPSKDDTYWKEINAAMALTNLAQGKDEVQGTTTSCIIQKSSH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Mkx (ARP39996_P050) antibody |
Blocking Peptide |
For anti-Mkx (ARP39996_P050) antibody is Catalog # AAP39996 (Previous Catalog # AAPP21910) |
Uniprot ID |
B2RQ30 |
Protein Name |
Homeobox protein Mohawk Ensembl ENSMUSP00000078718 |
Protein Accession # |
NP_808263 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_177595 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Mkx |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 83% |
Image 1 | Mouse Brain
| WB Suggested Anti-Mkx Antibody Titration: 1.0 ug/ml Positive Control: Mouse Brain |
|
|