Mkx Antibody - C-terminal region (ARP39996_P050)

Data Sheet
 
Product Number ARP39996_P050
Product Page www.avivasysbio.com/mkx-antibody-c-terminal-region-arp39996-p050.html
Name Mkx Antibody - C-terminal region (ARP39996_P050)
Protein Size (# AA) 354 amino acids
Molecular Weight 39kDa
NCBI Gene Id 210719
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Mohawk homeobox
Alias Symbols Ir, Irxl1, 9430023B20Rik
Peptide Sequence Synthetic peptide located within the following region: GDSAANRRGPSKDDTYWKEINAAMALTNLAQGKDEVQGTTTSCIIQKSSH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Mkx (ARP39996_P050) antibody
Blocking Peptide For anti-Mkx (ARP39996_P050) antibody is Catalog # AAP39996 (Previous Catalog # AAPP21910)
Uniprot ID B2RQ30
Protein Name Homeobox protein Mohawk Ensembl ENSMUSP00000078718
Protein Accession # NP_808263
Purification Affinity Purified
Nucleotide Accession # NM_177595
Tested Species Reactivity Mouse
Gene Symbol Mkx
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 83%
Image 1
Mouse Brain
WB Suggested Anti-Mkx Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com