| Product Number |
ARP39992_T100 |
| Product Page |
www.avivasysbio.com/znf596-antibody-c-terminal-region-arp39992-t100.html |
| Name |
ZNF596 Antibody - C-terminal region (ARP39992_T100) |
| Protein Size (# AA) |
498 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
169270 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 596 |
| Peptide Sequence |
Synthetic peptide located within the following region: CGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVHTGEK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wistow,G., Unpublished (2002) |
| Description of Target |
ZNF596 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
| Protein Interactions |
STAT5A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF596 (ARP39992_T100) antibody |
| Blocking Peptide |
For anti-ZNF596 (ARP39992_T100) antibody is Catalog # AAP39992 (Previous Catalog # AAPP22908) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF596 |
| Uniprot ID |
Q8TC21 |
| Protein Name |
Zinc finger protein 596 |
| Protein Accession # |
NP_775810 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_173539 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF596 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Pig: 86%; Rat: 90% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF596 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate |
|
|
