| Product Number |
ARP39986_T100 |
| Product Page |
www.avivasysbio.com/znf57-antibody-c-terminal-region-arp39986-t100.html |
| Name |
ZNF57 Antibody - C-terminal region (ARP39986_T100) |
| Protein Size (# AA) |
555 amino acids |
| Molecular Weight |
64kDa |
| NCBI Gene Id |
126295 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 57 |
| Alias Symbols |
ZNF424 |
| Peptide Sequence |
Synthetic peptide located within the following region: LHNHVRMHTGEKPHKCKQCGMSFKWHSSFRNHLRMHTGQKSHECQSYSKA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Lichter,P., (1992) Genomics 13 (4), 999-1007 |
| Description of Target |
The function of ZNF57 remains unkonwn. |
| Protein Interactions |
SUV39H2; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF57 (ARP39986_T100) antibody |
| Blocking Peptide |
For anti-ZNF57 (ARP39986_T100) antibody is Catalog # AAP39986 (Previous Catalog # AAPP21901) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF57 |
| Uniprot ID |
Q8N6R9 |
| Protein Name |
Zinc finger protein 57 |
| Protein Accession # |
NP_775751 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_173480 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF57 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Horse, Pig, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 85%; Human: 100%; Mouse: 85%; Pig: 83%; Rat: 82%; Zebrafish: 83% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF57 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
|
