ZNF550 Antibody - middle region (ARP39949_T100)

• Product Number: ARP39949_T100
• Name: ZNF550 Antibody - middle region (ARP39949_T100)
• Protein Size (# AA): 381 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 162972
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 550
• Peptide Sequence: Synthetic peptide located within the following region: CTQCGKAFHRSTYLIQHSVIHTGEMPYKCIECGKAFKRRSHLLQHQRVHT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kim,Y.S., Unpublished (1998)
• Description of Target: ZNF550 contains 1 KRAB domain and 8 C2H2-type zinc fingers. ZNF550 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
• Protein Interactions: REL;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF550 (ARP39949_T100) antibody is Catalog # AAP39949 (Previous Catalog # AAPP10262)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF550
• Uniprot ID: Q7Z398
• Protein Name: Zinc finger protein 550
• Protein Accession #: NP_001034743
• Purification: Protein A purified
• Nucleotide Accession #: NM_001039654
• Tested Species Reactivity: Human
• Gene Symbol: ZNF550
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZNF550 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysate