Product Number |
ARP39942_T100 |
Product Page |
www.avivasysbio.com/znf488-antibody-c-terminal-region-arp39942-t100.html |
Name |
ZNF488 Antibody - C-terminal region (ARP39942_T100) |
Protein Size (# AA) |
340 amino acids |
Molecular Weight |
37kDa |
NCBI Gene Id |
118738 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 488 |
Peptide Sequence |
Synthetic peptide located within the following region: VFHMRSHHKKEHAGPDPHSQKRREEALACPVCQEHFRERHHLSRHMTSHS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kim,Y.S., Unpublished (2003) |
Description of Target |
ZNF488 is a candidate transcription factor |
Protein Interactions |
TRAF2; GOLGA2; DAB1; KRT40; PRR20A; RIMBP3; BANP; RBPMS; MAGED1; ATXN1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF488 (ARP39942_T100) antibody |
Blocking Peptide |
For anti-ZNF488 (ARP39942_T100) antibody is Catalog # AAP39942 (Previous Catalog # AAPP10255) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF488 |
Uniprot ID |
Q96MN9 |
Protein Name |
Zinc finger protein 488 |
Protein Accession # |
NP_694579 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_153034 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF488 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF488 Antibody Titration: 2.5ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
|