| Product Number |
ARP39941_P050 |
| Product Page |
www.avivasysbio.com/znf488-antibody-n-terminal-region-arp39941-p050.html |
| Name |
ZNF488 Antibody - N-terminal region (ARP39941_P050) |
| Protein Size (# AA) |
340 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
118738 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 488 |
| Peptide Sequence |
Synthetic peptide located within the following region: TMAAGKGAPLSPSAENRWRLSEPELGRGCKPVLLEKTNRLGPEAAVGRAG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Xiao,J.H., Unpublished (2003) |
| Description of Target |
ZNF488 is a candidate transcription factor. |
| Protein Interactions |
TRAF2; GOLGA2; DAB1; KRT40; PRR20A; RIMBP3; BANP; RBPMS; MAGED1; ATXN1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF488 (ARP39941_P050) antibody |
| Blocking Peptide |
For anti-ZNF488 (ARP39941_P050) antibody is Catalog # AAP39941 (Previous Catalog # AAPP10254) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF488 |
| Uniprot ID |
Q96MN9 |
| Protein Name |
Zinc finger protein 488 |
| Protein Accession # |
NP_694579 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153034 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF488 |
| Predicted Species Reactivity |
Human, Mouse, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 79%; Human: 100%; Mouse: 77%; Pig: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF488 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
|
