MIER3 Antibody - middle region (ARP39920_P050)

• Product Number: ARP39920_P050
• Name: MIER3 Antibody - middle region (ARP39920_P050)
• Protein Size (# AA): 549 amino acids
• Molecular Weight: 61kDa
• NCBI Gene Id: 166968
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mesoderm induction early response 1, family member 3
• Alias Symbols: DKFZP781I1119, DKFZp686L09111, DKFZp781G1119, DKFZp781I1119, FLJ35954
• Peptide Sequence: Synthetic peptide located within the following region: MNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
• Description of Target: MIER3 is a transcriptional repressor.
• Protein Interactions: SUMO1; HDAC1; HDAC2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MIER3 (ARP39920_P050) antibody is Catalog # AAP39920 (Previous Catalog # AAPP10234)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MIER3
• Uniprot ID: Q7Z3K6-3
• Protein Name: Mesoderm induction early response protein 3
• Protein Accession #: NP_689835
• Purification: Affinity Purified
• Nucleotide Accession #: NM_152622
• Tested Species Reactivity: Human
• Gene Symbol: MIER3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
• Image 1: Human COLO205
  
  WB Suggested Anti-MIER3 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: COLO205 cell lysate