| Product Number |
ARP39917_P050 |
| Product Page |
www.avivasysbio.com/zfp759-antibody-n-terminal-region-arp39917-p050.html |
| Name |
Zfp759 Antibody - N-terminal region (ARP39917_P050) |
| Protein Size (# AA) |
368 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
268670 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 759 |
| Alias Symbols |
Rsl, Rslcan8, BC028265, Rslcan-8 |
| Peptide Sequence |
Synthetic peptide located within the following region: LGPPQWKLYRDVMLENYNNLVFLGLASSKPYLVRFLEQIQEPLDVKSQVA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Zfp759 (ARP39917_P050) antibody |
| Blocking Peptide |
For anti-Zfp759 (ARP39917_P050) antibody is Catalog # AAP39917 (Previous Catalog # AAPY02235) |
| Protein Accession # |
EDL10320 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_172392 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Zfp759 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 92% |
| Image 1 | Mouse Pancreas
 | WB Suggested Anti-Zfp759 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Pancreas |
|
|
