| Product Number |
ARP39906_T100 |
| Product Page |
www.avivasysbio.com/nkx6-3-antibody-n-terminal-region-arp39906-t100.html |
| Name |
NKX6-3 Antibody - N-terminal region (ARP39906_T100) |
| Protein Size (# AA) |
135 amino acids |
| Molecular Weight |
14kDa |
| NCBI Gene Id |
157848 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
NK6 homeobox 3 |
| Alias Symbols |
NKX6.3 |
| Peptide Sequence |
Synthetic peptide located within the following region: RLCSGPWGLPELQPAAPSSSAAQLPWGESWGEEADTPACLSASGVWFQNR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Sugano,S. Unpublished (2001) |
| Description of Target |
Nkx6.3 is a new member of the Nkx6 subfamily of homeodomain proteins. Members of the Nkx family of homeodomain proteins are involved in a variety of developmental processes such as cell fate determination in the CNS and in the pancreas. Nkx6.3 is expressed in the developing CNS and gastro-intestinal tract. Nkx6.3 shows a remarkably selective expression in a subpopulation of differentiating V2 neurons at caudal hindbrain levels. In the gut, Nkx6.3 is expressed in duodenal and glandular stomach endoderm and at the end of gestation Nkx6.3 became restricted to the base of the gastric units in the glandular stomach. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NKX6-3 (ARP39906_T100) antibody |
| Blocking Peptide |
For anti-NKX6-3 (ARP39906_T100) antibody is Catalog # AAP39906 (Previous Catalog # AAPP10220) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NKX6-3 |
| Uniprot ID |
Q96LR0 |
| Protein Name |
Homeobox protein Nkx-6.3 |
| Protein Accession # |
NP_689781 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_152568 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NKX6-3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-NKX6-3 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
