ZNF786 Antibody - N-terminal region (ARP39890_T100)

Data Sheet
 
Product Number ARP39890_T100
Product Page www.avivasysbio.com/znf786-antibody-n-terminal-region-arp39890-t100.html
Name ZNF786 Antibody - N-terminal region (ARP39890_T100)
Protein Size (# AA) 120 amino acids
Molecular Weight 13kDa
NCBI Gene Id 136051
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 786
Peptide Sequence Synthetic peptide located within the following region: MAEPPRLPLTFEDVAIYFSEQEWQDLEAWQKELYKHVMRSNYETLVSLDD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Mural,R.J., (2005) Direct Submission
Description of Target The function remains unknown.
Protein Interactions KRTAP10-3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF786 (ARP39890_T100) antibody
Blocking Peptide For anti-ZNF786 (ARP39890_T100) antibody is Catalog # AAP39890 (Previous Catalog # AAPP23213)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF786
Uniprot ID Q8N393
Protein Name Zinc finger protein 786
Protein Accession # EAW80063
Purification Protein A purified
Nucleotide Accession # NM_152411
Tested Species Reactivity Human
Gene Symbol ZNF786
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 77%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-ZNF786 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human Lung
Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com