Product Number |
ARP39890_T100 |
Product Page |
www.avivasysbio.com/znf786-antibody-n-terminal-region-arp39890-t100.html |
Name |
ZNF786 Antibody - N-terminal region (ARP39890_T100) |
Protein Size (# AA) |
120 amino acids |
Molecular Weight |
13kDa |
NCBI Gene Id |
136051 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 786 |
Peptide Sequence |
Synthetic peptide located within the following region: MAEPPRLPLTFEDVAIYFSEQEWQDLEAWQKELYKHVMRSNYETLVSLDD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Mural,R.J., (2005) Direct Submission |
Description of Target |
The function remains unknown. |
Protein Interactions |
KRTAP10-3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF786 (ARP39890_T100) antibody |
Blocking Peptide |
For anti-ZNF786 (ARP39890_T100) antibody is Catalog # AAP39890 (Previous Catalog # AAPP23213) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF786 |
Uniprot ID |
Q8N393 |
Protein Name |
Zinc finger protein 786 |
Protein Accession # |
EAW80063 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_152411 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF786 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 77%; Rat: 93% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF786 Antibody Titration: 1.25ug/ml Positive Control: HepG2 cell lysate |
| Image 2 | Human Lung
| Human Lung |
|
|