ZNF440 Antibody - N-terminal region (ARP39886_T100)

Data Sheet
 
Product Number ARP39886_T100
Product Page www.avivasysbio.com/znf440-antibody-n-terminal-region-arp39886-t100.html
Name ZNF440 Antibody - N-terminal region (ARP39886_T100)
Protein Size (# AA) 595 amino acids
Molecular Weight 69kDa
NCBI Gene Id 126070
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 440
Peptide Sequence Synthetic peptide located within the following region: VNFTQEEWALLDISQRKLYREVMLETFRNLTSLGKRWKDQNIEYEHQNPR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Isogai,T. Unpublished (2002)
Description of Target ZNF440 contains 1 KRAB domain and 12 C2H2-type zinc fingers. ZNF440 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Protein Interactions NOTCH2NL; KRTAP10-1; KRTAP10-9; MTUS2; MID2; TRAF1; MDFI; UBC; XBP1; PAX9; MAP4K5; KRTAP4-12; PJA1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF440 (ARP39886_T100) antibody
Blocking Peptide For anti-ZNF440 (ARP39886_T100) antibody is Catalog # AAP39886 (Previous Catalog # AAPP21896)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF440
Uniprot ID Q8IYI8
Protein Name Zinc finger protein 440
Protein Accession # NP_689570
Purification Protein A purified
Nucleotide Accession # NM_152357
Tested Species Reactivity Human
Gene Symbol ZNF440
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HepG2
WB Suggested Anti-ZNF440 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com