| Product Number |
ARP39869_T100 |
| Product Page |
www.avivasysbio.com/zscan21-antibody-c-terminal-region-arp39869-t100.html |
| Name |
ZSCAN21 Antibody - C-terminal region (ARP39869_T100) |
| Protein Size (# AA) |
473 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
7589 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger and SCAN domain containing 21 |
| Alias Symbols |
ZNF38, Zipro1, NY-REN-21 |
| Peptide Sequence |
Synthetic peptide located within the following region: AFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Carneiro,F.R., (2006) Biochem. Biophys. Res. Commun. 343 (1), 260-268 |
| Description of Target |
ZSCAN21 belongs to the krueppel C2H2-type zinc-finger protein family and is a strong transcriptional activator. |
| Protein Interactions |
KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-9; KRT40; TRIM41; ZNF496; ZKSCAN7; ZNF446; ZNF24; UBC; BRCA1; SCAND1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZSCAN21 (ARP39869_T100) antibody |
| Blocking Peptide |
For anti-ZSCAN21 (ARP39869_T100) antibody is Catalog # AAP39869 (Previous Catalog # AAPP10055) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZSCAN21 |
| Uniprot ID |
Q9Y5A6 |
| Protein Name |
Zinc finger and SCAN domain-containing protein 21 |
| Protein Accession # |
NP_666019 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_145914 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZSCAN21 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-ZSCAN21 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T |
|
|
