| Product Number |
ARP39864_P050 |
| Product Page |
www.avivasysbio.com/znf396-antibody-n-terminal-region-arp39864-p050.html |
| Name |
ZNF396 Antibody - N-terminal region (ARP39864_P050) |
| Protein Size (# AA) |
333 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
252884 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 396 |
| Alias Symbols |
ZSCAN14 |
| Peptide Sequence |
Synthetic peptide located within the following region: TQTSEECNGILTEKMEEEEQTCDPDSSLHWSSSYSPETFRQQFRQFGYQD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wu,Y., Gene 310, 193-201 (2003) |
| Description of Target |
ZNF396 acts as a DNA-dependent transcriptional repressor. |
| Protein Interactions |
ZNF446; ZSCAN32; ZNF24; ZSCAN1; ZNF397; ZNF396; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF396 (ARP39864_P050) antibody |
| Blocking Peptide |
For anti-ZNF396 (ARP39864_P050) antibody is Catalog # AAP39864 (Previous Catalog # AAPP21875) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF396 |
| Uniprot ID |
Q96N95-3 |
| Protein Name |
Zinc finger protein 396 |
| Protein Accession # |
NP_665699 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_145756 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF396 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 90%; Dog: 90%; Guinea Pig: 90%; Horse: 90%; Human: 100%; Mouse: 90%; Rabbit: 92%; Rat: 90% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF396 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
|
