| Product Number |
ARP39863_T100 |
| Product Page |
www.avivasysbio.com/gsh2-antibody-c-terminal-region-arp39863-t100.html |
| Name |
GSH2 Antibody - C-terminal region (ARP39863_T100) |
| Protein Size (# AA) |
304 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
170825 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
GS homeobox 2 |
| Alias Symbols |
GSH2, DMJDS2 |
| Peptide Sequence |
Synthetic peptide located within the following region: LLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Cools,J., (2002) Blood 99 (5), 1776-1784 |
| Description of Target |
homeobox protein GSH-2 |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GSX2 (ARP39863_T100) antibody |
| Blocking Peptide |
For anti-GSX2 (ARP39863_T100) antibody is Catalog # AAP39863 (Previous Catalog # AAPP21874) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GSH2 |
| Uniprot ID |
Q9BZM3 |
| Protein Name |
GS homeobox 2 |
| Protein Accession # |
NP_573574 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_133267 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GSX2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human LN18
 | WB Suggested Anti-GSH2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: LN18 cell lysate |
|
|
