ZNF31 Antibody - N-terminal region (ARP39855_T100)

• Product Number: ARP39855_T100
• Name: ZNF31 Antibody - N-terminal region (ARP39855_T100)
• Protein Size (# AA): 433 amino acids
• Molecular Weight: 49kDa
• NCBI Gene Id: 7579
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger and SCAN domain containing 20
• Alias Symbols: KOX29, ZNF31, ZFP-31, ZNF360
• Peptide Sequence: Synthetic peptide located within the following region: MAMALELQAQASPQPEPEELLIVKLEEDSWGSESKLWEKDRGSVSGPEAS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Thiesen,H.J. (1990) New Biol. 2 (4), 363-374
• Description of Target: ZNF31contains 1 KRAB domain and 10 C2H2-type zinc fingers. ZNF31 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
• Protein Interactions: BAG3; UBC; SCAND1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZSCAN20 (ARP39855_T100) antibody is Catalog # AAP39855 (Previous Catalog # AAPP21866)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF31
• Uniprot ID: Q96FA9
• Protein Name: Zinc finger and SCAN domain-containing protein 20
• Protein Accession #: AAH11404
• Purification: Protein A purified
• Nucleotide Accession #: NM_145238
• Tested Species Reactivity: Human
• Gene Symbol: ZSCAN20
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 92%; Horse: 92%; Human: 100%; Pig: 85%
• Image 1: Human HepG2
  
  WB Suggested Anti-ZNF31 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:62500
  Positive Control: HepG2 cell lysate