ZNF25 Antibody - C-terminal region (ARP39841_T100)

Data Sheet
 
Product Number ARP39841_T100
Product Page www.avivasysbio.com/znf25-antibody-c-terminal-region-arp39841-t100.html
Name ZNF25 Antibody - C-terminal region (ARP39841_T100)
Protein Size (# AA) 362 amino acids
Molecular Weight 40kDa
NCBI Gene Id 219749
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 25
Alias Symbols Zfp9, KOX19
Peptide Sequence Synthetic peptide located within the following region: EKPYACKECGKSFSQKSHFIIHQRKHTGEKPYECQECGETFIQKSQLTAH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tunnacliffe,A., (1993) Nucleic Acids Res. 21 (6), 1409-1417
Description of Target ZNF25 contains 1 KRAB domain and 12 C2H2-type zinc fingers. ZNF25 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF25 (ARP39841_T100) antibody
Blocking Peptide For anti-ZNF25 (ARP39841_T100) antibody is Catalog # AAP39841 (Previous Catalog # AAPP21855)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF25
Uniprot ID P17030-2
Protein Name Zinc finger protein 25
Protein Accession # CAD38845
Purification Protein A purified
Nucleotide Accession # NM_145011
Tested Species Reactivity Human
Gene Symbol ZNF25
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 85%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-ZNF25 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com