Product Number |
ARP39841_T100 |
Product Page |
www.avivasysbio.com/znf25-antibody-c-terminal-region-arp39841-t100.html |
Name |
ZNF25 Antibody - C-terminal region (ARP39841_T100) |
Protein Size (# AA) |
362 amino acids |
Molecular Weight |
40kDa |
NCBI Gene Id |
219749 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 25 |
Alias Symbols |
Zfp9, KOX19 |
Peptide Sequence |
Synthetic peptide located within the following region: EKPYACKECGKSFSQKSHFIIHQRKHTGEKPYECQECGETFIQKSQLTAH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Tunnacliffe,A., (1993) Nucleic Acids Res. 21 (6), 1409-1417 |
Description of Target |
ZNF25 contains 1 KRAB domain and 12 C2H2-type zinc fingers. ZNF25 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF25 (ARP39841_T100) antibody |
Blocking Peptide |
For anti-ZNF25 (ARP39841_T100) antibody is Catalog # AAP39841 (Previous Catalog # AAPP21855) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF25 |
Uniprot ID |
P17030-2 |
Protein Name |
Zinc finger protein 25 |
Protein Accession # |
CAD38845 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_145011 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF25 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 85%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF25 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
|