Product Number |
ARP39838_P050 |
Product Page |
www.avivasysbio.com/zfp472-antibody-n-terminal-region-arp39838-p050.html |
Name |
Zfp472 Antibody - N-terminal region (ARP39838_P050) |
Protein Size (# AA) |
534 amino acids |
Molecular Weight |
58kDa |
NCBI Gene Id |
224691 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 472 |
Alias Symbols |
Krim, Krim-, Krim1, KRIM-1, Krim-1A, Krim-1B |
Peptide Sequence |
Synthetic peptide located within the following region: TLGEWTMLDSSQKKLYRDVMKETFLNLISIGKTEEEDTEEEYQNPKGNLR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Zfp472 (ARP39838_P050) antibody |
Blocking Peptide |
For anti-Zfp472 (ARP39838_P050) antibody is Catalog # AAP39838 (Previous Catalog # AAPP21852) |
Uniprot ID |
E9Q2M4 |
Protein Name |
Protein Zfp867 Ensembl ENSMUSP00000050746 |
Protein Accession # |
NP_694703 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_153063 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Zfp472 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 93% |
Image 1 | Mouse Brain
| WB Suggested Anti-Zfp472 Antibody Titration: 1.0 ug/ml Positive Control: Mouse Brain |
|
|