| Product Number |
ARP39834_P050 |
| Product Page |
www.avivasysbio.com/znf558-antibody-n-terminal-region-arp39834-p050.html |
| Name |
ZNF558 Antibody - N-terminal region (ARP39834_P050) |
| Protein Size (# AA) |
402 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
148156 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 558 |
| Peptide Sequence |
Synthetic peptide located within the following region: AAPSSLFPASQQKGHTQGGELVNELLTSWLRGLVTFEDVAVEFTQEEWAL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Lehner,B. (2004) Genome Res. 14 (7), 1315-1323 |
| Description of Target |
ZNF588 contains 1 KRAB domain and 9 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
| Protein Interactions |
EXOSC5; APOE; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF558 (ARP39834_P050) antibody |
| Blocking Peptide |
For anti-ZNF558 (ARP39834_P050) antibody is Catalog # AAP39834 (Previous Catalog # AAPP21848) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF558 |
| Uniprot ID |
Q96NG5 |
| Protein Name |
Zinc finger protein 558 |
| Protein Accession # |
NP_653294 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_144693 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF558 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF558 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
|
