ZNF545 Antibody - C-terminal region (ARP39800_P050)

Data Sheet
 
Product Number ARP39800_P050
Product Page www.avivasysbio.com/znf545-antibody-c-terminal-region-arp39800-p050.html
Name ZNF545 Antibody - C-terminal region (ARP39800_P050)
Protein Size (# AA) 532 amino acids
Molecular Weight 63kDa
NCBI Gene Id 284406
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 82 homolog (mouse)
Alias Symbols ZNF545
Peptide Sequence Synthetic peptide located within the following region: CRKAFRLNSSLIQHLRIHSGEKPYECKECKKAFRQHSHLTHHLKIHNVKI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Koehrer,K., Unpublished (2004)
Description of Target ZNF545 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Protein Interactions CBX5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZFP82 (ARP39800_P050) antibody
Blocking Peptide For anti-ZFP82 (ARP39800_P050) antibody is Catalog # AAP39800 (Previous Catalog # AAPP10052)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF545
Uniprot ID Q8N141
Protein Name Zinc finger protein 82 homolog
Protein Accession # NP_597723
Purification Affinity Purified
Nucleotide Accession # NM_133466
Tested Species Reactivity Human
Gene Symbol ZFP82
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%
Image 1
Transfected 293T
WB Suggested Anti-ZNF545 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com