Product Number |
ARP39800_P050 |
Product Page |
www.avivasysbio.com/znf545-antibody-c-terminal-region-arp39800-p050.html |
Name |
ZNF545 Antibody - C-terminal region (ARP39800_P050) |
Protein Size (# AA) |
532 amino acids |
Molecular Weight |
63kDa |
NCBI Gene Id |
284406 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 82 homolog (mouse) |
Alias Symbols |
ZNF545 |
Peptide Sequence |
Synthetic peptide located within the following region: CRKAFRLNSSLIQHLRIHSGEKPYECKECKKAFRQHSHLTHHLKIHNVKI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Koehrer,K., Unpublished (2004) |
Description of Target |
ZNF545 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
Protein Interactions |
CBX5; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZFP82 (ARP39800_P050) antibody |
Blocking Peptide |
For anti-ZFP82 (ARP39800_P050) antibody is Catalog # AAP39800 (Previous Catalog # AAPP10052) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF545 |
Uniprot ID |
Q8N141 |
Protein Name |
Zinc finger protein 82 homolog |
Protein Accession # |
NP_597723 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_133466 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZFP82 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93% |
Image 1 | Transfected 293T
| WB Suggested Anti-ZNF545 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Transfected 293T |
|
|