MSL3L1 Antibody - C-terminal region (ARP39784_T100)

Data Sheet
 
Product Number ARP39784_T100
Product Page www.avivasysbio.com/msl3l1-antibody-c-terminal-region-arp39784-t100.html
Name MSL3L1 Antibody - C-terminal region (ARP39784_T100)
Protein Size (# AA) 355 amino acids
Molecular Weight 41kDa
NCBI Gene Id 10943
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Male-specific lethal 3 homolog (Drosophila)
Alias Symbols MRSXBA, MRXS36, MRXSBA, MSL3L1
Peptide Sequence Synthetic peptide located within the following region: FSEKNLKALLKHFDLFLRFLAEYHDDFFPESAYVAACEAHYSTKNPRAIY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Beausoleil,S.A., et al., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
Description of Target MSL3L1 is a nuclear protein, which is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation.
Protein Interactions PAF1; DYRK1B; SOX2; UBC; CDK6; APP; HIST4H4; HIST3H3; MSL1; KAT8; PRKDC; MSL2; HIST1H4A; HIST1H3A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MSL3 (ARP39784_T100) antibody
Blocking Peptide For anti-MSL3 (ARP39784_T100) antibody is Catalog # AAP39784 (Previous Catalog # AAPP10051)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MSL3L1
Uniprot ID Q5T295
Protein Name NAD-dependent protein deacylase sirtuin-5, mitochondrial
Protein Accession # NP_006791
Purification Protein A purified
Nucleotide Accession # NM_006800
Tested Species Reactivity Human
Gene Symbol MSL3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Spleen
WB Suggested Anti-MSL3L1 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:62500
Positive Control: Human Spleen
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com