| Product Number |
ARP39776_P050 |
| Product Page |
www.avivasysbio.com/egln2-antibody-c-terminal-region-arp39776-p050.html |
| Name |
Egln2 Antibody - C-terminal region (ARP39776_P050) |
| Protein Size (# AA) |
415 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
308457 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
EGL nine homolog 2 (C. elegans) |
| Alias Symbols |
PHD1, HPH-1, HPH-3, PHD-1, HIF-PH1 |
| Peptide Sequence |
Synthetic peptide located within the following region: FWSDRRNPHEVKPAYATRYAITVWYFDAKERAAARDKYQLASGQKGVQVP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
HIF-prolyl hydroxylase 1; might be involved in might play a role in hypoxic preconditioning. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Egln2 (ARP39776_P050) antibody |
| Blocking Peptide |
For anti-Egln2 (ARP39776_P050) antibody is Catalog # AAP39776 (Previous Catalog # AAPP10603) |
| Uniprot ID |
Q6AYU4 |
| Protein Name |
Egl nine homolog 2 |
| Protein Accession # |
NP_001004083 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001004083 |
| Tested Species Reactivity |
Human, Rat |
| Gene Symbol |
Egln2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Rat Muscle
 | WB Suggested Anti-Egln2 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Muscle |
| | Image 2 | Human Colon
 | Rabbit Anti-Egln2 antibody
Catalog Number: ARP39776
Formalin Fixed Paraffin Embedded Tissue: Human Colon
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
|
|
|
