| Product Number |
ARP39756_T100 |
| Product Page |
www.avivasysbio.com/btbd6-antibody-n-terminal-region-arp39756-t100.html |
| Name |
BTBD6 Antibody - N-terminal region (ARP39756_T100) |
| Protein Size (# AA) |
410 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
90135 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
BTB (POZ) domain containing 6 |
| Alias Symbols |
BDPL |
| Peptide Sequence |
Synthetic peptide located within the following region: FVVGPPGATRTVPAHKYVLAVGSSVFYAMFYGDLAEVKSEIHIPDVEPAA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wistow,G., (er) Mol. Vis. 8, 171-184 (2002) |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
DAXX; PAXIP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-BTBD6 (ARP39756_T100) antibody |
| Blocking Peptide |
For anti-BTBD6 (ARP39756_T100) antibody is Catalog # AAP39756 (Previous Catalog # AAPS03505) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BTBD6 |
| Uniprot ID |
Q96KE9 |
| Protein Name |
BTB/POZ domain-containing protein 6 |
| Protein Accession # |
NP_150374 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_033271 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BTBD6 |
| Predicted Species Reactivity |
Human, Cow, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Rabbit: 79%; Zebrafish: 79% |
| Image 1 | Human Intestine
 | Human Intestine |
| | Image 2 | Human HepG2
 | WB Suggested Anti-BTBD6 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate |
|
|
