ZNF682 antibody - N-terminal region (ARP39750_T100)
Data Sheet
Product Number ARP39750_T100
Product Page www.avivasysbio.com/znf682-antibody-n-terminal-region-arp39750-t100.html
Product Name ZNF682 antibody - N-terminal region (ARP39750_T100)
Size 100 ul
Gene Symbol ZNF682
Alias Symbols BC39498_3
Protein Size (# AA) 498 amino acids
Molecular Weight 58kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 91120
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Zinc finger protein 682
Description This is a rabbit polyclonal antibody against ZNF682. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: ENYRNLVSLGLTVSKPELISRLEQRQEPWNVKRHETIAKPPAMSSHYTED
Target Reference Isogai,T. Unpublished (1999)
Description of Target ZNF682 contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF682 may be involved in transcriptional regulation.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ZNF682 (ARP39750_T100) antibody is Catalog # AAP39750 (Previous Catalog # AAPP21775)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF682
Complete computational species homology data Anti-ZNF682 (ARP39750_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZNF682.
Swissprot Id O95780
Protein Name Zinc finger protein 682
Protein Accession # NP_149973
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZNF682.
Nucleotide Accession # NM_033196
Conjugation Options

ARP39750_T100-FITC Conjugated

ARP39750_T100-HRP Conjugated

ARP39750_T100-Biotin Conjugated

Species Reactivity Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%
Image 1
Human Jurkat
WB Suggested Anti-ZNF682 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com