| Product Number |
ARP39742_T100 |
| Product Page |
www.avivasysbio.com/cpxcr1-antibody-n-terminal-region-arp39742-t100.html |
| Name |
CPXCR1 Antibody - N-terminal region (ARP39742_T100) |
| Protein Size (# AA) |
301 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
53336 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
CPX chromosome region, candidate 1 |
| Alias Symbols |
CT77 |
| Peptide Sequence |
Synthetic peptide located within the following region: SDTAGNAHKNSENEPPNDCSTDIESPSADPNMIYQVETNPINREPGTATS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Braybrook,C., (2001) Hum. Genet. 108 (6), 537-545 |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
Dlg4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CPXCR1 (ARP39742_T100) antibody |
| Blocking Peptide |
For anti-CPXCR1 (ARP39742_T100) antibody is Catalog # AAP39742 (Previous Catalog # AAPS03411) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CPXCR1 |
| Uniprot ID |
Q96RS3 |
| Protein Name |
CPX chromosomal region candidate gene 1 protein |
| Protein Accession # |
NP_149037 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_033048 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CPXCR1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-CPXCR1 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
|
|
