Product Number |
ARP39728_T100 |
Product Page |
www.avivasysbio.com/atoh8-antibody-n-terminal-region-arp39728-t100.html |
Name |
ATOH8 Antibody - N-terminal region (ARP39728_T100) |
Protein Size (# AA) |
321 amino acids |
Molecular Weight |
35kDa |
NCBI Gene Id |
84913 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Atonal homolog 8 (Drosophila) |
Alias Symbols |
HATH6, bHLHa21 |
Peptide Sequence |
Synthetic peptide located within the following region: PWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Wasserman,S.M., (2002) (er) Physiol. Genomics 12 (1), 13-23 |
Description of Target |
The function of ATOH8 remains unknown. |
Protein Interactions |
CYP3A5; TCF3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ATOH8 (ARP39728_T100) antibody |
Blocking Peptide |
For anti-ATOH8 (ARP39728_T100) antibody is Catalog # AAP39728 (Previous Catalog # AAPP21753) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ATOH8 |
Uniprot ID |
Q96SQ7 |
Protein Name |
Protein atonal homolog 8 |
Protein Accession # |
NP_116216 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_032827 |
Tested Species Reactivity |
Human |
Gene Symbol |
ATOH8 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ATOH8 Antibody Titration: 2.5ug/ml ELISA Titer: 1:12500 Positive Control: Jurkat cell lysate |
|
|