ATOH8 Antibody - N-terminal region (ARP39728_T100)

Data Sheet
 
Product Number ARP39728_T100
Product Page www.avivasysbio.com/atoh8-antibody-n-terminal-region-arp39728-t100.html
Name ATOH8 Antibody - N-terminal region (ARP39728_T100)
Protein Size (# AA) 321 amino acids
Molecular Weight 35kDa
NCBI Gene Id 84913
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Atonal homolog 8 (Drosophila)
Alias Symbols HATH6, bHLHa21
Peptide Sequence Synthetic peptide located within the following region: PWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wasserman,S.M., (2002) (er) Physiol. Genomics 12 (1), 13-23
Description of Target The function of ATOH8 remains unknown.
Protein Interactions CYP3A5; TCF3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ATOH8 (ARP39728_T100) antibody
Blocking Peptide For anti-ATOH8 (ARP39728_T100) antibody is Catalog # AAP39728 (Previous Catalog # AAPP21753)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ATOH8
Uniprot ID Q96SQ7
Protein Name Protein atonal homolog 8
Protein Accession # NP_116216
Purification Protein A purified
Nucleotide Accession # NM_032827
Tested Species Reactivity Human
Gene Symbol ATOH8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-ATOH8 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com