RIOX2 Antibody - N-terminal region (ARP39721_P050)

Data Sheet
 
Product Number ARP39721_P050
Product Page www.avivasysbio.com/riox2-antibody-n-terminal-region-arp39721-p050.html
Name RIOX2 Antibody - N-terminal region (ARP39721_P050)
Protein Size (# AA) 280 amino acids
Molecular Weight 32kDa
NCBI Gene Id 84864
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ribosomal oxygenase 2
Alias Symbols ROX, MDIG, MINA, NO52, JMJD10, MINA53
Peptide Sequence Synthetic peptide located within the following region: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zhang,Y., (2005) Oncogene 24 (31), 4873-4882
Description of Target MINA is a c-Myc (MYC; MIM 190080) target gene that may play a role in cell proliferation or regulation of cell growth. (Tsuneoka et al., 2002 [PubMed 12091391]; Zhang et al., 2005 [PubMed 15897898]).[supplied by OMIM, May 2008]
Protein Interactions MINA; UBC; NAA16; TXNL1; APP; MYBBP1A; MYC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RIOX2 (ARP39721_P050) antibody
Blocking Peptide For anti-RIOX2 (ARP39721_P050) antibody is Catalog # AAP39721 (Previous Catalog # AAPP21746)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MINA
Uniprot ID Q8IUF6
Protein Name ribosomal oxygenase 2
Protein Accession # NP_694822
Purification Affinity Purified
Nucleotide Accession # NM_153182
Tested Species Reactivity Human
Gene Symbol RIOX2
Predicted Species Reactivity Human, Rat, Horse, Pig, Rabbit
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Horse: 79%; Human: 100%; Pig: 86%; Rabbit: 79%; Rat: 79%
Image 1
Human kidney
Human kidney
Image 2
Human HepG2
WB Suggested Anti-MINA Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Image 3
Human thyroid tissue
Rabbit Anti-MINA Antibody
Catalog Number: ARP39721_P050
Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue
Observed Staining: Cytoplasm in follicular cells
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com