| Product Number |
ARP39715_T100 |
| Product Page |
www.avivasysbio.com/znf496-antibody-n-terminal-region-arp39715-t100.html |
| Product Name |
ZNF496 antibody - N-terminal region (ARP39715_T100) |
| Size |
100 ul |
| Gene Symbol |
ZNF496 |
| Alias Symbols |
NIZP1, ZFP496, ZKSCAN17 |
| Protein Size (# AA) |
587 amino acids |
| Molecular Weight |
67kDa |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| NCBI Gene Id |
84838 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Official Gene Full Name |
Zinc finger protein 496 |
| Description |
This is a rabbit polyclonal antibody against ZNF496. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Peptide Sequence |
Synthetic peptide located within the following region: MPTALCPRVLAPKESEEPRKMRSPPGENPSPQGELPSPESSRRLFRRFRY |
| Target Reference |
Rual,J.F., (2005) Nature 437 (7062), 1173-1178 |
| Description of Target |
ZNF496 contains a SCAN box, a KRAB-A domain, and four consensus C2H2-type zinc fingers preceded by a unique finger derivative, referred to herein as the C2HR motif. The C2HR motif functions to mediate protein-protein interaction with the cysteine-rich (C5HCH) domain of NSD1 in a Zn(II)-dependent fashion, and when tethered to RNA polymerase II promoters, represses transcription in an NSD1-dependent manner. ZNF496 contains a novel type of zinc finger motif that functions as a docking site for NSD1 and is more than just a degenerate evolutionary remnant of a C2H2 motif. |
| Protein Interactions |
ZKSCAN4; ZSCAN22; ZNF483; ZNF446; ZSCAN12; ZSCAN21; ARR3; Nsd1; SUMO2; UBC; CBX3; TRIM28; NR3C1; POLR3D; ZZZ3; JADE2; RAI1; SSX3; SUPT5H; PPARG; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Lead Time |
Domestic: within 1-2 days delivery International: 1-2 days |
| Blocking Peptide |
For anti-ZNF496 (ARP39715_T100) antibody is Catalog # AAP39715 (Previous Catalog # AAPP21740) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF496 |
| Complete computational species homology data |
Anti-ZNF496 (ARP39715_T100) |
| Tissue Tool |
Find tissues and cell lines supported by DNA array analysis to express ZNF496.  |
| Swissprot Id |
Q96IT1 |
| Protein Name |
Zinc finger protein 496 |
| Protein Accession # |
NP_116141 |
| Purification |
Protein A purified |
| RNA Seq |
Find tissues and cell lines supported by RNA-seq analysis to express ZNF496.  |
| Nucleotide Accession # |
NM_032752 |
| Replacement Item |
This antibody may replace item sc-102228 from Santa Cruz Biotechnology. |
| Conjugation Options |
ARP39715_T100-FITC Conjugated ARP39715_T100-HRP Conjugated ARP39715_T100-Biotin Conjugated |
| CB Replacement |
sc-102228 |
| Species Reactivity |
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF496 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
