ZNF496 antibody - N-terminal region (ARP39715_T100)
Data Sheet
Product Number ARP39715_T100
Product Page www.avivasysbio.com/znf496-antibody-n-terminal-region-arp39715-t100.html
Product Name ZNF496 antibody - N-terminal region (ARP39715_T100)
Size 100 ul
Gene Symbol ZNF496
Alias Symbols NIZP1, ZFP496, ZKSCAN17
Protein Size (# AA) 587 amino acids
Molecular Weight 67kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 84838
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Zinc finger protein 496
Description This is a rabbit polyclonal antibody against ZNF496. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: MPTALCPRVLAPKESEEPRKMRSPPGENPSPQGELPSPESSRRLFRRFRY
Target Reference Rual,J.F., (2005) Nature 437 (7062), 1173-1178
Description of Target ZNF496 contains a SCAN box, a KRAB-A domain, and four consensus C2H2-type zinc fingers preceded by a unique finger derivative, referred to herein as the C2HR motif. The C2HR motif functions to mediate protein-protein interaction with the cysteine-rich (C5HCH) domain of NSD1 in a Zn(II)-dependent fashion, and when tethered to RNA polymerase II promoters, represses transcription in an NSD1-dependent manner. ZNF496 contains a novel type of zinc finger motif that functions as a docking site for NSD1 and is more than just a degenerate evolutionary remnant of a C2H2 motif.
Protein Interactions ZKSCAN4; ZSCAN22; ZNF483; ZNF446; ZSCAN12; ZSCAN21; ARR3; Nsd1; SUMO2; UBC; CBX3; TRIM28; NR3C1; POLR3D; ZZZ3; JADE2; RAI1; SSX3; SUPT5H; PPARG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ZNF496 (ARP39715_T100) antibody is Catalog # AAP39715 (Previous Catalog # AAPP21740)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF496
Complete computational species homology data Anti-ZNF496 (ARP39715_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZNF496.
Swissprot Id Q96IT1
Protein Name Zinc finger protein 496
Protein Accession # NP_116141
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZNF496.
Nucleotide Accession # NM_032752
Replacement Item This antibody may replace item sc-102228 from Santa Cruz Biotechnology.
Conjugation Options

ARP39715_T100-FITC Conjugated

ARP39715_T100-HRP Conjugated

ARP39715_T100-Biotin Conjugated

CB Replacement sc-102228
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Image 1
Human HepG2
WB Suggested Anti-ZNF496 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com