ZNF496 Antibody - N-terminal region (ARP39715_T100)

Data Sheet
 
Product Number ARP39715_T100
Product Page www.avivasysbio.com/znf496-antibody-n-terminal-region-arp39715-t100.html
Name ZNF496 Antibody - N-terminal region (ARP39715_T100)
Protein Size (# AA) 587 amino acids
Molecular Weight 67kDa
NCBI Gene Id 84838
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 496
Alias Symbols NIZP1, ZFP496, ZSCAN49, ZKSCAN17
Peptide Sequence Synthetic peptide located within the following region: MPTALCPRVLAPKESEEPRKMRSPPGENPSPQGELPSPESSRRLFRRFRY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Rual,J.F., (2005) Nature 437 (7062), 1173-1178
Description of Target ZNF496 contains a SCAN box, a KRAB-A domain, and four consensus C2H2-type zinc fingers preceded by a unique finger derivative, referred to herein as the C2HR motif. The C2HR motif functions to mediate protein-protein interaction with the cysteine-rich (C5HCH) domain of NSD1 in a Zn(II)-dependent fashion, and when tethered to RNA polymerase II promoters, represses transcription in an NSD1-dependent manner. ZNF496 contains a novel type of zinc finger motif that functions as a docking site for NSD1 and is more than just a degenerate evolutionary remnant of a C2H2 motif.
Protein Interactions ZKSCAN4; ZSCAN22; ZNF483; ZNF446; ZSCAN12; ZSCAN21; ARR3; Nsd1; SUMO2; UBC; CBX3; TRIM28; NR3C1; POLR3D; ZZZ3; JADE2; RAI1; SSX3; SUPT5H; PPARG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF496 (ARP39715_T100) antibody
Blocking Peptide For anti-ZNF496 (ARP39715_T100) antibody is Catalog # AAP39715 (Previous Catalog # AAPP21740)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF496
Uniprot ID Q96IT1
Protein Name Zinc finger protein 496
Protein Accession # NP_116141
Purification Protein A purified
Nucleotide Accession # NM_032752
Tested Species Reactivity Human
Gene Symbol ZNF496
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Image 1
Human HepG2
WB Suggested Anti-ZNF496 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com