| Product Number |
ARP39707_T100 |
| Product Page |
www.avivasysbio.com/insm2-antibody-n-terminal-region-arp39707-t100.html |
| Name |
INSM2 Antibody - N-terminal region (ARP39707_T100) |
| Protein Size (# AA) |
566 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
84684 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Insulinoma-associated 2 |
| Alias Symbols |
IA6, IA-6, mlt1 |
| Peptide Sequence |
Synthetic peptide located within the following region: KRTGGLYRVRLAERVFPLLGPQGAPPFLEEAPSASLPGAERATPPTREEP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
The function of INSM2 remains unknown. |
| Protein Interactions |
ZSCAN1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-INSM2 (ARP39707_T100) antibody |
| Blocking Peptide |
For anti-INSM2 (ARP39707_T100) antibody is Catalog # AAP39707 (Previous Catalog # AAPP21732) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human INSM2 |
| Uniprot ID |
Q96Q84 |
| Protein Name |
Insulinoma-associated protein 2 |
| Protein Accession # |
NP_115983 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_032594 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
INSM2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-INSM2 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
|
