PGBD1 Antibody - C-terminal region (ARP39704_T100)

Data Sheet
 
Product Number ARP39704_T100
Product Page www.avivasysbio.com/pgbd1-antibody-c-terminal-region-arp39704-t100.html
Name PGBD1 Antibody - C-terminal region (ARP39704_T100)
Protein Size (# AA) 809 amino acids
Molecular Weight 93kDa
NCBI Gene Id 84547
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name PiggyBac transposable element derived 1
Alias Symbols SCAND4, HUCEP-4, dJ874C20.4
Peptide Sequence Synthetic peptide located within the following region: PQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDVA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Suzuki,Y., (1997) Gene 200 (1-2), 149-156
Description of Target PGBD1 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known.
Protein Interactions ZSCAN22; PGBD1; ZNF446; SCAND1; ZNF24; TRAF2; MEOX2; NR4A1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PGBD1 (ARP39704_T100) antibody
Blocking Peptide For anti-PGBD1 (ARP39704_T100) antibody is Catalog # AAP39704 (Previous Catalog # AAPP21729)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PGBD1
Uniprot ID Q96JS3
Protein Name PiggyBac transposable element-derived protein 1
Protein Accession # NP_115896
Purification Protein A purified
Nucleotide Accession # NM_032507
Tested Species Reactivity Human
Gene Symbol PGBD1
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 86%
Image 1
Human HepG2
WB Suggested Anti-PGBD1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com