Product Number |
ARP39703_T100 |
Product Page |
www.avivasysbio.com/pgbd1-antibody-n-terminal-region-arp39703-t100.html |
Name |
PGBD1 Antibody - N-terminal region (ARP39703_T100) |
Protein Size (# AA) |
809 amino acids |
Molecular Weight |
93kDa |
NCBI Gene Id |
84547 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
PiggyBac transposable element derived 1 |
Alias Symbols |
SCAND4, HUCEP-4, dJ874C20.4 |
Peptide Sequence |
Synthetic peptide located within the following region: MYEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRLRFRHF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Suzuki,Y., (1997) Gene 200 (1-2), 149-156 |
Description of Target |
PGBD1 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. |
Protein Interactions |
ZSCAN22; PGBD1; ZNF446; SCAND1; ZNF24; TRAF2; MEOX2; NR4A1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PGBD1 (ARP39703_T100) antibody |
Blocking Peptide |
For anti-PGBD1 (ARP39703_T100) antibody is Catalog # AAP39703 (Previous Catalog # AAPP21728) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PGBD1 |
Uniprot ID |
Q96JS3 |
Protein Name |
PiggyBac transposable element-derived protein 1 |
Protein Accession # |
NP_115896 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_032507 |
Tested Species Reactivity |
Human |
Gene Symbol |
PGBD1 |
Predicted Species Reactivity |
Human, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 75%; Human: 100%; Pig: 92%; Rabbit: 92% |
Image 1 | Human HepG2
| WB Suggested Anti-PGBD1 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|