| Product Number |
ARP39650_P050 |
| Product Page |
www.avivasysbio.com/tcf7l2-antibody-n-terminal-region-arp39650-p050.html |
| Name |
TCF7L2 Antibody - N-terminal region (ARP39650_P050) |
| Protein Size (# AA) |
619 amino acids |
| Molecular Weight |
68 kDa |
| NCBI Gene Id |
6934 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
transcription factor 7 like 2 |
| Alias Symbols |
TCF4, TCF-4 |
| Peptide Sequence |
Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. The protein has been implicated in blood glucose homeostasis. Genetic variants of this gene are associated with increased risk of type 2 diabetes. Several transcript variants encoding multiple different isoforms have been found for this gene. |
| Protein Interactions |
Ctnnb1; Hdac1; Hdac2; Hnf4a; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TCF7L2 (ARP39650_P050) antibody |
| Blocking Peptide |
For anti-TCF7L2 (ARP39650_P050) antibody is Catalog # AAP39650 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7L2 |
| Uniprot ID |
Q9NQB0 |
| Protein Name |
Transcription factor 7-like 2 |
| Protein Accession # |
XP_005270141 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
XM_005270084.1 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
TCF7L2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 75%; Guinea Pig: 75%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human HCT15 Whole Cell
 | Host: Rabbit
Target Name: TCF7L2
Sample Tissue: Human HCT15 Whole Cell lysates
Antibody Dilution: 1ug/ml |
| | Image 2 | Mouse Kidney
 | Host: Mouse
Target Name: TCF7L2
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml |
|
|
