ZNF419A Antibody - C-terminal region (ARP39607_T100)

Data Sheet
 
Product Number ARP39607_T100
Product Page www.avivasysbio.com/znf419a-antibody-c-terminal-region-arp39607-t100.html
Name ZNF419A Antibody - C-terminal region (ARP39607_T100)
Protein Size (# AA) 510 amino acids
Molecular Weight 59kDa
NCBI Gene Id 79744
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 419
Alias Symbols ZAPHIR, ZNF419A
Peptide Sequence Synthetic peptide located within the following region: GRLFRENSSLVKHQRVHTGAKPYECRECGKFFRHNSSLFKHRRIHTGEMQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target ZNF419A contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF419A may be involved in transcriptional regulation.
Protein Interactions KRTAP10-7; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF419 (ARP39607_T100) antibody
Blocking Peptide For anti-ZNF419 (ARP39607_T100) antibody is Catalog # AAP39607 (Previous Catalog # AAPP21627)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF419A
Uniprot ID Q96HQ0
Protein Name Zinc finger protein 419
Protein Accession # NP_078967
Purification Protein A purified
Nucleotide Accession # NM_024691
Tested Species Reactivity Human
Gene Symbol ZNF419
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 85%; Rabbit: 92%; Rat: 83%; Sheep: 77%
Image 1
Human HepG2
WB Suggested Anti-ZNF419A Antibody Titration: 2.5ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com