Product Number |
ARP39607_T100 |
Product Page |
www.avivasysbio.com/znf419a-antibody-c-terminal-region-arp39607-t100.html |
Name |
ZNF419A Antibody - C-terminal region (ARP39607_T100) |
Protein Size (# AA) |
510 amino acids |
Molecular Weight |
59kDa |
NCBI Gene Id |
79744 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 419 |
Alias Symbols |
ZAPHIR, ZNF419A |
Peptide Sequence |
Synthetic peptide located within the following region: GRLFRENSSLVKHQRVHTGAKPYECRECGKFFRHNSSLFKHRRIHTGEMQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
Description of Target |
ZNF419A contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF419A may be involved in transcriptional regulation. |
Protein Interactions |
KRTAP10-7; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF419 (ARP39607_T100) antibody |
Blocking Peptide |
For anti-ZNF419 (ARP39607_T100) antibody is Catalog # AAP39607 (Previous Catalog # AAPP21627) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF419A |
Uniprot ID |
Q96HQ0 |
Protein Name |
Zinc finger protein 419 |
Protein Accession # |
NP_078967 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_024691 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF419 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 85%; Rabbit: 92%; Rat: 83%; Sheep: 77% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF419A Antibody Titration: 2.5ug/ml ELISA Titer: 1:12500 Positive Control: HepG2 cell lysate |
|
|