| Product Number |
ARP39605_P050 |
| Product Page |
www.avivasysbio.com/znf322a-antibody-c-terminal-region-arp39605-p050.html |
| Name |
ZNF322A Antibody - C-terminal region (ARP39605_P050) |
| Protein Size (# AA) |
402 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
79692 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 322 |
| Alias Symbols |
HCG12, ZNF388, ZNF489, ZNF322A |
| Peptide Sequence |
Synthetic peptide located within the following region: YTVCDKSFHQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Li,Y., (2004) Biochem. Biophys. Res. Commun. 325 (4), 1383-1392 |
| Description of Target |
ZNF322 contains four exons and spans 23.2kb in chromosome 6p22.1 region, and transcribes a 2.7kb mRNA that encodes a protein with 402 amino acid residues.Through northern blot analysis, ZNF322 was shown to be expressed in every human tissue examined at adult stage and during embryonic developmental stages from 80 days to 24 weeks. When ZNF322 was overexpressed in COS-7 cells, ZNF322-EGFP fusion protein is detected in the nucleus and cytoplasm. Reporter gene assays show that ZNF322 is a transcriptional activator. Furthermore, overexpression of ZNF322 in COS-7 cells activates the transcriptional activity of SRE and AP-1. Together, these results suggest that ZNF322 is a member of the zinc-finger transcription factor family and may act as a positive regulator in gene transcription mediated by the MAPK signaling pathways. |
| Protein Interactions |
APP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF322 (ARP39605_P050) antibody |
| Blocking Peptide |
For anti-ZNF322 (ARP39605_P050) antibody is Catalog # AAP39605 (Previous Catalog # AAPP21625) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF322A |
| Uniprot ID |
Q6U7Q0 |
| Protein Name |
Zinc finger protein 322 |
| Protein Accession # |
NP_078915 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_024639 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF322 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 100%; Goat: 92%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 92%; Rabbit: 92%; Rat: 79% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF322A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate |
| | Image 2 | Human Stomach
 | Human Stomach |
|
|
