HOXB4 Antibody - C-terminal region (ARP39582_P050)

• Product Number: ARP39582_P050
• Name: HOXB4 Antibody - C-terminal region (ARP39582_P050)
• Protein Size (# AA): 251 amino acids
• Molecular Weight: 28kDa
• NCBI Gene Id: 3214
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Homeobox B4
• Alias Symbols: HOX2, HOX2F, HOX-2.6
• Peptide Sequence: Synthetic peptide located within the following region: TRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAAGSA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Pineault,N., (2004) Mol. Cell. Biol. 24 (5), 1907-1917
• Description of Target: HOXB4 is a member of the Antp homeobox family and is a nuclear protein with a homeobox DNA-binding domain. The protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion.
• Protein Interactions: DDB1; RBX1; CUL4A; CREBBP; EP300; MEIS1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HOXB4 (ARP39582_P050) antibody is Catalog # AAP39582 (Previous Catalog # AAPP21602)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB4
• Uniprot ID: P17483
• Protein Name: Homeobox protein Hox-B4
• Protein Accession #: NP_076920
• Purification: Affinity Purified
• Nucleotide Accession #: NM_024015
• Tested Species Reactivity: Human
• Gene Symbol: HOXB4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
• Image 1: Transfected 293T
  
  WB Suggested Anti-HOXB4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Transfected 293T