Product Number |
ARP39581_T100 |
Product Page |
www.avivasysbio.com/hoxb4-antibody-n-terminal-region-arp39581-t100.html |
Name |
HOXB4 Antibody - N-terminal region (ARP39581_T100) |
Protein Size (# AA) |
251 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
3214 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Homeobox B4 |
Alias Symbols |
HOX2, HOX2F, HOX-2.6 |
Peptide Sequence |
Synthetic peptide located within the following region: FLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Pineault,N., (2004) Mol. Cell. Biol. 24 (5), 1907-1917 |
Description of Target |
HOXB4 is a nuclear protein with a homeobox DNA-binding domain. The protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion. |
Protein Interactions |
DDB1; RBX1; CUL4A; CREBBP; EP300; MEIS1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HOXB4 (ARP39581_T100) antibody |
Blocking Peptide |
For anti-HOXB4 (ARP39581_T100) antibody is Catalog # AAP39581 (Previous Catalog # AAPP21594) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB4 |
Uniprot ID |
P17483 |
Protein Name |
Homeobox protein Hox-B4 |
Protein Accession # |
NP_076920 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_024015 |
Tested Species Reactivity |
Human |
Gene Symbol |
HOXB4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-HOXB4 Antibody Titration: 1.0ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
|